SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011265549.1.72520 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011265549.1.72520
Domain Number 1 Region: 12-140
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 4.18e-40
Family Cytidine deaminase 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011265549.1.72520
Sequence length 150
Comment PREDICTED: uncharacterized protein LOC105256947 [Camponotus floridanus]; AA=GCF_000147175.1; RF=representative genome; TAX=104421; STAX=104421; NAME=Camponotus floridanus; AL=Scaffold; RT=Major
Sequence
MYTGEIVDFTTLDKDIQELIRESAAVREKSYSPYSKFKVGAAVRCTDGSISRGCNVENAS
FPASVCAETAAIVHAVSEGKKKFTALTVVADQENVKFTTPCGVCRQVISEFFGDNIPIYL
TRSDMKQVLRTKTSELFPFSPFHTSDTKTS
Download sequence
Identical sequences E2AX72
Cflo_04477--XP_001122944.1_APIME XP_011265549.1.72520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]