SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011281572.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011281572.1.62641
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.16e-92
Family Calponin-homology domain, CH-domain 0.00000306
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-34
Family Spectrin repeat 0.0000942
Further Details:      
 
Domain Number 3 Region: 2170-2289
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-33
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 4 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-29
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 1647-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-28
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 6 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-28
Family Spectrin repeat 0.00000348
Further Details:      
 
Domain Number 7 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 8 Region: 1532-1675
Classification Level Classification E-value
Superfamily Spectrin repeat 5.17e-25
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 9 Region: 1229-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 1.66e-24
Family Spectrin repeat 0.0007
Further Details:      
 
Domain Number 10 Region: 815-949
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-23
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 11 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-22
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 1.6e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-19
Family Spectrin repeat 0.00061
Further Details:      
 
Domain Number 14 Region: 1351-1447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000209
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 15 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011281572.1.62641
Sequence length 2326
Comment PREDICTED: spectrin beta chain, erythrocytic [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSNLARVPCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTMEGRETRSAKDALL
LWCQMKTAGYPQVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALREELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELEKENYHDQKRITARKDNILRLWNYLQELLRARRQRLETTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLQFTEGKGY
QPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDTHLEQIFQEAEGMVARKQFGHPQIEARIKE
VSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLEELEESRGVMEHLEQQAQDFPQEFRDSPDVTNRLQALRELYQQVVAQADLR
RQRLQDALDLYTVFGETDACELWMGEKEKWLAQMEIPDTLEDLEVAQHRFDILDQEMKTL
MIQIDGVNLAANSLVDSSHPRSGEVKQYQDHLNSRWLAFQTVVSERREAVNSALRVRNYC
VDCEETSKWIEDKMHVVRSTKDLGQDLAGVIAIQRKLSGLERDVAAIQARVGALERESQQ
LMASHPEQREDIGQRQACVEQLWKDLQEALQEQEASLGEASQLQAFLQNLDDFQSWLSMA
QKAVASEDMPESLPEAEQLLQQHAAIKDEIDGHQESYQHVRVSGENVIRDQTDPEYLLLG
QRLEGLDAGWDALCRMWESRNHSLAQCLGFQEFQRDAKQAEAILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLMSMENNQDKVLSPVDSGNKLVADKNLYSDKILEKVQLIEDRHRKNK
EKAQEASATLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEVRNLQNKWLKHQAFVA
DLASHQGWLDSIDAEGKQLMEEKPHYLALVSQRLEDLHRLWDELQATTQERTQHLSAARN
SYLRSQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELLA
QVPSLGDEAEDTDVSIEKRFLDLLEPLERRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSADYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLQRGQRLVEVAEVDCQDIEERLG
RLQGLWDTLREAAAGRLQRLRDASEAQQYYLDAGEAEAWISEQELYIISDETPKDEEGAI
VMLKRHLRQQHTVEEYGRNIKQLASRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAE
ERRRKLENMYHLFQLKREADDLEQWITEKERMASSLEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNIIIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASHDLH
RYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELQMLGLQVQQFQDVAT
RLQTAYAGEKADAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFLSMVRDLLSWME
GIIRQIETQERPRDVSSVELLMKYHQGIKAEIETRSKNFSACLELGESLLQRQHQASEEI
SEKLKQVLYRRKEMNERWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHT
VDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQTPERPEEEPGPQEEEGETAG
EAPRGPHRAATERTSPGEEERQWPQDLQPPPPPGQEEKSSGDERPTTEPLYKVLDTPLSE
GDEPATLPAQRDHGYSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTFYKDAK
NLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLSWLQG
VSTAINESQSIRVKAQSLPLPSITGPDASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences M3VZY4
XP_011281572.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]