SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011370687.1.92234 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011370687.1.92234
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.93e-115
Family Capz alpha-1 subunit 0.000000000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011370687.1.92234
Sequence length 286
Comment PREDICTED: F-actin-capping protein subunit alpha-2 [Pteropus vampyrus]; AA=GCF_000151845.1; RF=representative genome; TAX=132908; STAX=132908; NAME=Pteropus vampyrus; AL=Scaffold; RT=Major
Sequence
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPYEAENAVESW
RTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFT
ITPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A0B8RZQ2 A0M8S9 A0M8V0 A9XFX7 L5KT22 Q07E36 Q29221
ENSCAFP00000005070 ENSSSCP00000017617 9823.ENSSSCP00000017618 9823.ENSSSCP00000017619 ENSCAFP00000005070 NP_001013013.1.84170 NP_001162163.1.62641 XP_006910645.1.64745 XP_011370687.1.92234 XP_014693830.1.49734 XP_015974800.1.101085 ENSSSCP00000017617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]