SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011370867.1.92234 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011370867.1.92234
Domain Number 1 Region: 8-159
Classification Level Classification E-value
Superfamily EF-hand 5.79e-45
Family Calmodulin-like 0.000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011370867.1.92234
Sequence length 161
Comment PREDICTED: troponin C, slow skeletal and cardiac muscles [Pteropus vampyrus]; AA=GCF_000151845.1; RF=representative genome; TAX=132908; STAX=132908; NAME=Pteropus vampyrus; AL=Scaffold; RT=Major
Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Download sequence
Identical sequences G3RIM2 H2PAJ6 H2QMR7 P02591 P63316 Q6FH91
ENSP00000232975 ENSP00000232975 ENSPPYP00000015449 NP_003271.1.87134 NP_003271.1.92137 XP_001172150.1.37143 XP_002713286.1.1745 XP_002813699.1.23681 XP_003818806.1.60992 XP_004034331.1.27298 XP_004581584.1.84141 XP_006917622.1.64745 XP_007950244.1.48129 XP_011370867.1.92234 XP_015977357.1.101085 ENSGGOP00000015532 gi|4507615|ref|NP_003271.1| ENSPTRP00000025903 ENSPPYP00000015449 9598.ENSPTRP00000025903 9600.ENSPPYP00000015449 9606.ENSP00000232975 9986.ENSOCUP00000006896 ENSOCUP00000006896 ENSP00000232975 ENSOCUP00000006896 ENSPTRP00000025903 ENSGGOP00000015532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]