SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011403539.2.10788 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011403539.2.10788
Domain Number 1 Region: 493-706
Classification Level Classification E-value
Superfamily Bet v1-like 1.37e-30
Family STAR domain 0.015
Further Details:      
 
Domain Number 2 Region: 62-168
Classification Level Classification E-value
Superfamily PH domain-like 4.62e-19
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011403539.2.10788
Sequence length 715
Comment PREDICTED: collagen type IV alpha-3-binding protein-like [Amphimedon queenslandica]; AA=GCF_000090795.1; RF=representative genome; TAX=400682; STAX=400682; NAME=Amphimedon queenslandica; AL=Scaffold; RT=Major
Sequence
MARLVKNFIGGIAFKVTGGDVYEVEDEEKESRTEDLKVGEERLTEGVEEGSSTSDEEEED
NFHINHPPYKMATLSKWTNYISGWQDRYVVVRDGILSYYKSEIDLQYGCRGSISLHKVSV
YIHEFDELRFDIRAHDCTYFFRAGDPTEKASWVEVIEANKAYLIENGPKPSIARQASIIS
LSGLSQASTSSFKTGHDLQVKLAEMETYRDILCKQIDVLQAYFDAGIESTISNDDGVNEV
VKSTDSIDELPEEGGEHHNGRYSPSPLTRSSESSRSSKLHDAGSSSSPVVGHRLTPKGHR
RTGSDPFSFRQMPHNRSPLLRSHGGSGATSGGFDFRGEAITFKATTAGILSSLKYCIDIM
NKREEYWQKKFEKEQERRRKADRAAHSALNGPRIRAYEYAGPDFEEGPHSALNEDEFYDA
LEMAYQEDELEIQPSQNSSPSKAVSQSDNKNNEAQPQIEAVLEDIVHKPYTGPEHKLTPL
VNEHVGKYSKYVFEPVESGDGNWQLAHEDGDMKVYRRELEEDGVVVDPLKAQHIVKGLSA
FEMCKYFFDKDTRLDWEGTVESFKVLDKLADDSVVFHQLHKRVWPSTQRETVFCSHICML
TNAPRPENMVGHTWMVCNFSMEHPSVPITSKMIRATLNVGLVCQTIINRQVEPGQESSIT
RDDVSCKIIYAANVNPGGWAPPSVVRTIAKREITKFLKKISSCAQKAVLEQPLTL
Download sequence
Identical sequences A0A1X7VWU2
XP_011403539.2.10788 Aqu1.230123|PACid:15728651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]