SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011471135.2.28442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011471135.2.28442
Domain Number 1 Region: 341-580
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-52
Family YWTD domain 0.00000212
Further Details:      
 
Domain Number 2 Region: 642-904
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-51
Family YWTD domain 0.00000464
Further Details:      
 
Domain Number 3 Region: 23-290
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-51
Family YWTD domain 0.00000317
Further Details:      
 
Domain Number 4 Region: 951-1205
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-34
Family YWTD domain 0.0000876
Further Details:      
 
Domain Number 5 Region: 1335-1371
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1258-1297
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 7 Region: 907-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000319
Family EGF-type module 0.036
Further Details:      
 
Domain Number 8 Region: 1298-1334
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 598-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 295-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000004
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1214-1268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000304
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011471135.2.28442
Sequence length 1634
Comment low-density lipoprotein receptor-related protein 5 [Oryzias latipes]; AA=GCF_000313675.1; RF=representative genome; TAX=8090; STAX=8090; NAME=Oryzias latipes; strain=Hd-rR; AL=Chromosome; RT=Major
Sequence
MGGLLAPRLLLWSCLLSAGSGSPLLLFANRRDVRLVDGEGPRGESAIVVSDLEDAAAVDF
FFAEGLIFWTDVSEEAIKQTRWNQSSNSLKESLGTDQIVVVPGLDSPDGLACDWLSKKLY
WTDSETNRIEVANLNGTSRKVLFWMDLDQPRAIALNPAQRYMYWTDWGEEPRIERAGMDG
SRREVIVNEDIFWPNGLTVDLEEQKLYWADAKLSFIHRANLDGSAREAVVEGTLTHPFAL
TLSNETLFWTDWQTHSIHACNKHRGDKTREILGGIYSPMGIQVLESYRQPYIRTPCSDNN
GGCSHLCLLSPVPPFYSCTCPTGVQLRADGKTCKPGAEQVLLLARRTDLRRISLDLPDFT
DIVLQVDGIRHAIAIDYDPVEGYVYWTDDEVRAIRRSRLDGSNAVMLVTTEINHPDGIAV
DWVSRNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAIVLDPVNGYMFWSDWGERPK
IERANLDGTDRLVLLNTSLGWPNGLALDYATGKLYWGDAKTDKIEVINVDGTGRKTLLED
KLPHIFGFTLLGDYIYWTDWQRRSIERVHKVTAVREIIIDQLPDLMGLKATKVTETHGTN
GCAVENGGCSHLCFWRRRAVSCACPMGMELLPDLQTCVVPEAFLLFTNRDSIRSISLGTN
SNDVAIPLTGIKEASALDFDVSEKRIYWTDIQAKTISRAYMNGSSVEHVIEFGLDYPEGM
AVDWMGHNIYWADTGTNRIEVARLDGQYRQVLVCKDLDNPRSLDNPRSLALDPANGFMYW
TEWGGLPRIARAYMDGSIITTLVEKVGRANGLTIDYVDHRLYWTDLDTYMIESSNMLGLQ
REIVVDDLPHPFGLTQYKDFIYWTDFNLRTIERADKRGGLNRTVILKGQLELMMDILVFH
SSRQDGTNECSLNNGDCAHLCLATPTGAQCRCTSHYTLNPDGRNCSSPSSFLLFTQKNSI
SRMVLGEQSPDIILPIHVVKARAVHYDPVDRLIYWLDGRQNIRRARDDGAMSSVMATSTA
QPVENQLHDLSLDPYSRHVYWTCENTNTINVQRMDGHTVGVVVKDNTDKPRAIVVNAERG
YMYFTTVQERSAKIEGASLDGTERESLFTTGLIRPVALALDNKLGKLFWIDADLKRIESS
DLTGANRVVLQDSNILQPMGLTVLGEHLYWIDRQQQMIERVDKLTGDRRTRVQGRISFLT
SIHAVEEMDPREFELHPCSRNNGGCSHICIAKGDGTPRCSCPIHLVLASDLLRCGEPPTC
SPEQFTCSTGDIDCIPLAWRCDGFPECEDGSDEDNCPVCSVSHFQCDEGSCIDAHKRCDG
EPDCADKSDEHDCEVICSPGEFRCGDNQCITKKQRCDGYSDCPDGLDELACDHAPPPSSF
NHDPKPIIPVIAIMLLVFVIGGVYFACQRVEWRCYKGPNGTFPRDYIGGTPHVPLNFIAP
SSSQHGTFQGISCGKSIMSSVSLMGSSSSGAPLYDRNHVTGASSSSSSSTKGAYYPQILN
PPPSPATDRSLYNTEIYSSNSPSTTRSYRPYHAIRGAAPPTTPCSTDVCDSDYTPHHLAA
GPPPSAGRWKASAHSGKHNKYYMDLNSDSDPYPPPPTPRSQYMSAEESCPPSPSTERSYF
HLCPPPPSPCTDSS
Download sequence
Identical sequences XP_011471135.2.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]