SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011514957.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011514957.1.92137
Domain Number 1 Region: 234-410
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.06e-25
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 520-635
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-16
Family Second domain of FERM 0.0018
Further Details:      
 
Weak hits

Sequence:  XP_011514957.1.92137
Domain Number - Region: 422-512
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0672
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011514957.1.92137
Sequence length 736
Comment PREDICTED: krev interaction trapped protein 1 isoform X1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQG
NSEITQGILDYVVETTKPISPANQGIRGKRVVLMKKFPLDGEKMGREASLFIVPSVVKDN
TKYTYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGD
SELLSRLLSERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLNHPETDRHITDQQGRSPLNICEENKQNNWEEAAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKP
LQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEARYNLL
KGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYV
GVNIKGLHLLNMETKALLISLKYGCFMWQLGDTDTCFQIHSMENKMSFIVHTKQAGLVVK
LLMKLNGQLMPTERNS
Download sequence
Identical sequences A4D1F7 O00522
gi|31581522|ref|NP_004903.2| gi|37221182|ref|NP_919437.1| gi|37221184|ref|NP_919438.1| gi|37221187|ref|NP_919436.1| ENSP00000344668 ENSP00000378013 ENSP00000378015 ENSP00000410909 ENSP00000344668 HR3417 NP_004903.2.87134 NP_004903.2.92137 NP_919436.1.87134 NP_919436.1.92137 NP_919437.1.87134 NP_919437.1.92137 NP_919438.1.87134 NP_919438.1.92137 XP_005250717.1.92137 XP_005250719.1.92137 XP_005250722.1.92137 XP_005250723.1.92137 XP_005250724.1.92137 XP_005250725.1.92137 XP_005250726.1.92137 XP_006716224.1.92137 XP_006716225.1.92137 XP_006716226.1.92137 XP_011514953.1.92137 XP_011514955.1.92137 XP_011514956.1.92137 XP_011514957.1.92137 XP_011514958.1.92137 XP_011514959.1.92137 XP_011514960.1.92137 XP_011514961.1.92137 XP_011514962.1.92137 XP_011514963.1.92137 XP_016868244.1.92137 XP_016868245.1.92137 XP_016868246.1.92137 ENSP00000344668 ENSP00000378013 ENSP00000378015 ENSP00000410909 9606.ENSP00000344668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]