SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011524917.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011524917.1.92137
Domain Number 1 Region: 147-460
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-100
Family Protein kinases, catalytic subunit 0.0000000000161
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 7.61e-25
Family Pleckstrin-homology domain (PH domain) 0.000000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011524917.1.92137
Sequence length 481
Comment PREDICTED: RAC-beta serine/threonine-protein kinase isoform X1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
Download sequence
Identical sequences P31751
gi|4502023|ref|NP_001617.1| ENSP00000375892 ENSP00000375892 ENSP00000399532 NP_001617.1.87134 NP_001617.1.92137 XP_011524916.1.92137 XP_011524917.1.92137 XP_011524918.1.92137 XP_011524920.1.92137 XP_011524921.1.92137 XP_011524922.1.92137 XP_016881959.1.92137 ENSP00000309428 9606.ENSP00000375892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]