SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011660028.1.97903 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011660028.1.97903
Domain Number 1 Region: 16-361
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.72e-113
Family IF2B-like 0.000000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011660028.1.97903
Sequence length 381
Comment PREDICTED: methylthioribose-1-phosphate isomerase [Cucumis sativus]; AA=GCF_000004075.2; RF=representative genome; TAX=3659; STAX=3659; NAME=Cucumis sativus; cultivar=9930; AL=Chromosome; RT=Major
Sequence
MALDSNNGGEVGVDNSLQSICYKRGSLRLLDQRKLPLETVYLDIKDATDGWHAIRDMVVR
GAPAIAISAALALAAEVNNSAPFNGTPNDAASFIADKLDYLVSSRPTAVNLGDAAIKLKE
IVSRAAAISSEASSVFQAFIEAAEAMLEDDVASNKAIGLYGANYIRDQQKSLEKFSVLTH
CNTGSLATAGYGTALGVIRALHSAGVLERAYCTETRPFNQGSRLTAYELVHEKIPSTLIA
DSAAAALMKFGRVNAVVVGADRVAANGDTANKIGTYSLALCAMHHKIPFFVAAPLTSIDL
SLSSGEEIVIEERSPKELLNSRGGLGEQVAASGIAVWNPAFDVTPAHLICGIITEKGVIT
KAGSDSFNIKEFVQKTAGPSA
Download sequence
Identical sequences A0A0A0LZL4
Cucsa.141850.1|PACid:16963538 Cucsa.141850.2|PACid:16963539 XP_011660028.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]