SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011725932.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011725932.1.29376
Domain Number 1 Region: 29-277
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.06e-91
Family Calponin-homology domain, CH-domain 0.00000315
Further Details:      
 
Domain Number 2 Region: 2168-2289
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-34
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 3 Region: 293-414
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 4 Region: 599-739
Classification Level Classification E-value
Superfamily Spectrin repeat 7.51e-29
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 5 Region: 1638-1791
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-28
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 6 Region: 1008-1162
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-28
Family Spectrin repeat 0.00000127
Further Details:      
 
Domain Number 7 Region: 1849-2003
Classification Level Classification E-value
Superfamily Spectrin repeat 3.34e-27
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 8 Region: 813-948
Classification Level Classification E-value
Superfamily Spectrin repeat 6.2e-25
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 9 Region: 1227-1373
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-24
Family Spectrin repeat 0.00077
Further Details:      
 
Domain Number 10 Region: 1530-1663
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-23
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 11 Region: 423-524
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-22
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 743-847
Classification Level Classification E-value
Superfamily Spectrin repeat 3.68e-19
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 13 Region: 527-633
Classification Level Classification E-value
Superfamily Spectrin repeat 1.33e-18
Family Spectrin repeat 0.00066
Further Details:      
 
Domain Number 14 Region: 2009-2068
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 1384-1480
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000995
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011725932.1.29376
Sequence length 2326
Comment PREDICTED: spectrin beta chain, erythrocytic [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MTSAAEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDVVDGNHRLVLGLIWTIILRFQIQDIVVPTQEGRETAKDALLLW
CQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDVAE
RQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIETEK
MIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKGNL
EVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKLEQ
LARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRALE
DLAQELEKENYHDQKRITARKDNILRLWSYLQELLRSRRQRLETTLALQKLFQDMLHSID
WMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTEGKGYQP
CDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMNEAESWIKEKEQIYSS
LDCGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVS
AQWDQLKDLAAFRKKNLQDAENFFQFQGDADDLKVWLQDAHRLLSGEDVGQDEGATRALG
KKHKDFLEELEESRGVMEHLEQQAQGFPEEFQDSPDVTHRLQALRELYQQVVAQADLRQQ
RLQEALDLYTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTLMT
QIDGVNLAANSLVESGHPRSGEVKQYQDHLNTRWQAFQTLVSKRREAVDSALRVHNYCVD
CEETSKWITDKTKVVESTKDLGRDLAGVIAIQRKLSGLERDVAAIQARVDALERESQQLM
DSHPEQKEDIGQRQKHLEELWQGLQQALRGQEDLLGEVSQLQAFLQDLDDFQAWLSITQK
AVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLLLGQR
LEGLDTGWDALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLEA
AEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNNEK
AEEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVAEL
ASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARSSD
LRLQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELFAQV
PSTGEEAGDVDLSIEKRFLDLLQPLGRRKKQLESSRAKLQINRDVEDETLWVEERLPLAQ
SADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLRHL
QSSWDKLQEAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAIVM
LKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLKDVAEER
KRKLENMYHLFQLKRETEDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETGAI
GQERVDNVNAFIERLIDAGHSKAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLHRY
FYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATRL
QTAYAGEKAEAIQNKEQEVSAMWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWMESI
IRQIETQERPRDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEIRE
KLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVD
SVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIAERPAEETGPQEEEGETAGEA
PVSHHAATERTSPGEEEGTWPQNLQQPPPPGQHEDGQKSAGDERPATEPLFKVLDTPLSE
GDEPATLLAPRDHGHSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTFYKDAK
NLALGMPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLSWLQG
VSTAINESQSIRVKAQSLPLPSLSGPDPSLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences A0A2K6E113
XP_011725932.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]