SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011728443.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011728443.1.29376
Domain Number 1 Region: 498-717
Classification Level Classification E-value
Superfamily Bet v1-like 5.43e-40
Family STAR domain 0.005
Further Details:      
 
Domain Number 2 Region: 123-243
Classification Level Classification E-value
Superfamily PH domain-like 6.68e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011728443.1.29376
Sequence length 726
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X4 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MQHSGIPIPPSPYCAPPTFLPLVIRESRRGLSSGGSTGRNAGVPATAAAADGWKGRLPSP
LVLLPRSARCQARRRRGERTSSLLLLPPTAELALFASPSPDPSPRGLGASSGAVEGAGAG
LLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNAL
SYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAI
EQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILC
RQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKLFPHVT
PKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEAYK
NAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTS
LPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENG
IVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRV
WPASQRDVLYLSAIRKISALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTL
VSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTA
GKPILF
Download sequence
Identical sequences XP_011728443.1.29376 XP_014995774.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]