SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011736323.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011736323.1.29376
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.3e-51
Family Calponin-homology domain, CH-domain 0.00000035
Further Details:      
 
Domain Number 2 Region: 201-263
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 6.54e-22
Family EB1 dimerisation domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011736323.1.29376
Sequence length 281
Comment PREDICTED: microtubule-associated protein RP/EB family member 3 isoform X1 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRK
VKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYD
GKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAP
PCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEH
ESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY
Download sequence
Identical sequences A0A0D9RAN0 A0A2I2Z4P6 A0A2K5MLB4 A0A2K5YP67 A0A2K6CF86 F7B5Z1 G7PLU4 H2P6Q7 K7CLN8 Q9UPY8
NP_001289979.1.87134 NP_001289979.1.92137 NP_036458.2.87134 NP_036458.2.92137 XP_004029023.1.27298 XP_007969378.1.81039 XP_008950680.1.60992 XP_008950681.1.60992 XP_009235742.1.23681 XP_009235743.1.23681 XP_011736323.1.29376 XP_011736324.1.29376 XP_011736325.1.29376 XP_011828050.1.47321 XP_011899688.1.92194 XP_014199267.1.60992 XP_014967422.1.72884 XP_016799295.1.37143 XP_016799302.1.37143 XP_016799309.1.37143 XP_017732389.1.44346 XP_017732390.1.44346 ENSMMUP00000025936 ENSPPYP00000014037 9544.ENSMMUP00000025936 9600.ENSPPYP00000014037 9606.ENSP00000233121 ENSP00000233121 ENSMMUP00000025936 ENSP00000233121 ENSP00000233121 ENSPPYP00000014037 gi|10800412|ref|NP_036458.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]