SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011743832.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011743832.1.29376
Domain Number 1 Region: 163-412
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-60
Family Voltage-gated potassium channels 0.00055
Further Details:      
 
Domain Number 2 Region: 37-134
Classification Level Classification E-value
Superfamily POZ domain 3.4e-27
Family Tetramerization domain of potassium channels 0.00000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011743832.1.29376
Sequence length 495
Comment PREDICTED: potassium voltage-gated channel subfamily A member 1 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MTVMSGENVDEASAAPGHPQDGSYPRQTDHDDHECCERVVINISGLRFETQLKTLAQFPN
TLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFY
ELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILIS
IVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLCIIWFSFELVVRF
FACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVF
RIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIP
DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE
GEEQAQLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTGNCTT
ANQNCVNKSKLLTDV
Download sequence
Identical sequences A0A096N578 A0A0D9SCZ1 A0A2K5HHJ2 A0A2K5KMH7 A0A2K5UKT9 A0A2K5XFR1 A0A2K6AM91 A0A2K6K5K5 A0A2K6NP85 F7DS72
ENSMMUP00000016103 ENSMMUP00000016103 9544.ENSMMUP00000016103 ENSPANP00000007587 XP_001102114.2.72884 XP_005569926.1.63531 XP_007965498.1.81039 XP_010357464.1.97406 XP_011743832.1.29376 XP_011806992.1.43180 XP_011851661.1.47321 XP_011909637.1.92194 XP_017738841.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]