SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011778508.1.14543 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011778508.1.14543
Domain Number 1 Region: 250-513,542-562
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.49e-80
Family Cryptochrome/photolyase FAD-binding domain 0.00000242
Further Details:      
 
Domain Number 2 Region: 23-204
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 8.24e-33
Family Cryptochrome/photolyase, N-terminal domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011778508.1.14543
Sequence length 568
Comment DNA repair enzyme, putative [Trypanosoma brucei gambiense DAL972]; AA=GCF_000210295.1; RF=representative genome; TAX=679716; STAX=5691; NAME=Trypanosoma brucei gambiense DAL972; strain=Dal 972 clone 1 (MHOM/CI/86/DAL972); AL=Chromosome; RT=Major
Sequence
MYVPSRVVAVKRQRTPSQPLPAAVFIFRRDFRVTDNTGLLLLIERAGKQSLPVIPLFFFN
PRQCDPDKNPYFGKACFEFLCQSLKHLDTVQLGGRLVCLRGSDCDCLEVVRSSGYDIKQL
GFNRDITPFARKRDLQLEEWCVKRGVRCVTSNMDYTLLPPDVVTNKNGKPYRVFSPFYRA
VLQEHFSDIQAPNPKATTIGDIFTGSHVKEDVKATVDQARRSAMAADEFSSLVDYVDLAA
LPQTFPELVDRGGRSEGLLRLASVASAKNYSAIRDDIPGDKTTHLSPHLKFGTISIREAM
QVALLHLGKEHAFTRQLIWREFYSMLLYHNPRLALGQLKMDVALQGERQCRATLANEPFL
EKYSNFQWEWNDAEFTAFKSGATGFPLVDAAVRCLTKTGWCHNRCRMLIANFLVKVLFVD
WREGERWYATVAVDYDVANNSGGWLWSSGQGADAQPYFRFFNPFRQSAQHDPQAVFIKQW
VPELRNVSVRTIHKWDVFCKEGRPADEGTLGTVQGTVKESNGIKKEKTELPLGGSIVGGS
AYPSPIVDLKQRTKWIVERYKKHAAEVI
Download sequence
Identical sequences D0A4Q0
XP_011778508.1.14543 Tbg972.10.13410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]