SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011791471.1.43180 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011791471.1.43180
Domain Number 1 Region: 32-126
Classification Level Classification E-value
Superfamily POZ domain 1.96e-27
Family Tetramerization domain of potassium channels 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011791471.1.43180
Sequence length 316
Comment PREDICTED: BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3 isoform X1 [Colobus angolensis palliatus]; AA=GCF_000951035.1; RF=representative genome; TAX=336983; STAX=54131; NAME=Colobus angolensis palliatus; AL=Scaffold; RT=Major
Sequence
MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAM
FSGRMEVLTDSEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGL
VEECQAALQQNKDTYEPFCKVPVITSSKEEQKLIATSNKPAVKLLYNRSNNKYSYTSNSD
DNMLKNIELFDKLSLRFNGRVLFIKDVIGDEICCWSFYGQGRKIAEVCCTSIVYATEKKQ
TKVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGGAAGRSHHLDEDEERERERIERV
RRIHIKRPDDRAHLHQ
Download sequence
Identical sequences H0WN36
ENSSSCP00000010601 9913.ENSBTAP00000003492 ENSOGAP00000003204 ENSOGAP00000003204 ENSSSCP00000010601 XP_004053916.2.27298 XP_004779170.1.14098 XP_005217966.1.76553 XP_005572246.1.63531 XP_006044892.1.26621 XP_006938708.1.62641 XP_007129562.1.24612 XP_007180158.1.59432 XP_008002823.1.81039 XP_008705849.1.72690 XP_008956182.1.60992 XP_009002819.1.60252 XP_009246494.1.23681 XP_009424486.1.37143 XP_010377828.1.97406 XP_011225798.1.58354 XP_011759424.1.29376 XP_011791471.1.43180 XP_011853224.1.47321 XP_011887876.1.92194 XP_011967827.1.54773 XP_012324543.1.9421 XP_012365442.1.23891 XP_012660736.1.62490 XP_014202795.1.60992 XP_015008195.1.72884 XP_017397101.1.71028 XP_017735204.1.44346 XP_017916584.1.57651 XP_019322735.1.44245 XP_019833316.1.53367 XP_020138624.1.48125 XP_021559177.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]