SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011832583.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011832583.1.47321
Domain Number 1 Region: 93-179
Classification Level Classification E-value
Superfamily PUA domain-like 1.06e-18
Family PUA domain 0.0039
Further Details:      
 
Weak hits

Sequence:  XP_011832583.1.47321
Domain Number - Region: 52-89
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0981
Family Hypothetical protein APE0525, N-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011832583.1.47321
Sequence length 182
Comment PREDICTED: malignant T-cell-amplified sequence 1 isoform X1 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MGKGRFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHI
EILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSP
GAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKT
YK
Download sequence
Identical sequences A0A1S3FA71 A0A250XVQ4 A0A287CYW1 A0A2I3HB06 A0A2I3MNA9 A0A2K5EFX7 A0A2K5KE70 A0A2K5P6M3 A0A2K5QBT8 A0A2K5V324 A0A2K5ZYA5 A0A2K6DM71 A0A2K6FU74 A0A2K6UFD6 F7GTQ4 G3R1X1 H2RCP2
ENSCJAP00000000088 ENSGGOP00000009204 ENSP00000360365 ENSP00000360367 ENSPTRP00000057617 ENSGGOP00000009204 gi|212276121|ref|NP_001131026.1| 9598.ENSPTRP00000047280 9606.ENSP00000360365 9615.ENSCAFP00000032244 ENSP00000360365 ENSPTRP00000057617 ENSCJAP00000000088 NP_001131026.1.87134 NP_001131026.1.92137 XP_001086539.1.72884 XP_003262330.1.23891 XP_003508391.1.69978 XP_003823185.1.60992 XP_003931143.1.74449 XP_004064860.1.27298 XP_004379639.1.4749 XP_004406979.1.74151 XP_004713108.1.18182 XP_005319404.1.77405 XP_005358491.1.66349 XP_005413711.1.28644 XP_005594546.1.63531 XP_005700402.1.57651 XP_005891586.1.15283 XP_005954000.1.78601 XP_006048869.1.26621 XP_006048870.1.26621 XP_006877536.1.41390 XP_006885128.1.29581 XP_007622333.1.28591 XP_008017656.1.81039 XP_008154343.1.99482 XP_008590561.1.73410 XP_008832148.1.79516 XP_008988099.1.60252 XP_010819664.1.76553 XP_011716863.1.29376 XP_011813380.1.43180 XP_011832583.1.47321 XP_011942920.1.92194 XP_012005527.1.54773 XP_012330954.1.9421 XP_012873548.1.60039 XP_015316898.1.76553 XP_015855637.1.50099 XP_017371826.1.71028 XP_020037487.1.5219 XP_020766770.1.74333 XP_020766777.1.74333 XP_021484567.1.76796 XP_521244.2.37143 XP_538160.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]