SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011847559.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_011847559.1.47321
Domain Number - Region: 6-36
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0353
Family RILP dimerisation region 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011847559.1.47321
Sequence length 175
Comment PREDICTED: tumor protein D53 isoform X4 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHD
MQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKS
FEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
Download sequence
Identical sequences A0A2K5XE53 F7DFW5
ENSMMUP00000004191 ENSP00000435447 ENSMMUP00000004191 gi|51173744|ref|NP_001003395.1| ENSP00000435447 9544.ENSMMUP00000004191 NP_001003395.1.87134 NP_001003395.1.92137 XP_003255709.1.23891 XP_003827659.1.60992 XP_004044683.1.27298 XP_005267179.1.92137 XP_011847559.1.47321 XP_011887044.1.92194 XP_017718515.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]