SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011851878.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011851878.1.47321
Domain Number 1 Region: 526-745
Classification Level Classification E-value
Superfamily Bet v1-like 5.63e-40
Family STAR domain 0.005
Further Details:      
 
Domain Number 2 Region: 125-245
Classification Level Classification E-value
Superfamily PH domain-like 7.19e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011851878.1.47321
Sequence length 754
Comment PREDICTED: collagen type IV alpha-3-binding protein [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MQHSGIPIPPSPYCAPPTFLPLVIRESRRGLSSGGSTGRNAGVPATAAAAAADGWKGRLP
SPLVLLPRSARCQARRRRGERTSSLLLLPPTAELALFASPSPDPSPRGLGASSGAVEGAG
AGLLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNN
ALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWID
AIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDI
LCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKLFPH
VTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEA
YKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWP
TSLPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQ
DVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRND
WETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKISALTENDPETWIVCN
FSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAP
ASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences A0A2I3LCQ5 A0A2K6AAN0
XP_011851878.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]