SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011896765.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011896765.1.92194
Domain Number 1 Region: 616-871
Classification Level Classification E-value
Superfamily YWTD domain 1.29e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 4-264
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-54
Family YWTD domain 0.00000161
Further Details:      
 
Domain Number 3 Region: 315-545
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-51
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 4 Region: 918-1175
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-37
Family YWTD domain 0.0000699
Further Details:      
 
Domain Number 5 Region: 1306-1342
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1228-1266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 7 Region: 1268-1304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 571-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000197
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 874-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 270-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000743
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1185-1237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000936
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011896765.1.92194
Sequence length 1586
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X2 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MTSPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQ
TYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQD
LDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKL
YWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGG
KRKEILSALYSPMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSPREPFYTCACPTGVQL
QDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYW
TDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTS
RKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRVLVNASLGWPNGLA
LDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIE
RVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPHATRCGCPI
GLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHI
YWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDG
QFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDL
TIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIE
RADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCA
SHHTLDPSSRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDK
FIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQNPDRQPHDLSIDIYSRTLFWTCEATNTIN
VHRLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTT
GLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPLGLTVLGKHLYW
IDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICI
AKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQ
SDEEGCPVCSAAHFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCV
LIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQR
VVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGG
VPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYR
PYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYMSAEDS
CPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences XP_011896765.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]