SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011980853.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011980853.1.54773
Domain Number 1 Region: 102-514
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.6e-119
Family Pyridoxal-dependent decarboxylase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011980853.1.54773
Sequence length 568
Comment PREDICTED: sphingosine-1-phosphate lyase 1 isoform X1 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MPSTDLMSLKAFEPYFEILEVYSTKAKNYVNGHCTKYEPWQLIVWSVVWTLLIVWVYEFV
FQPESLWSRFKKRCFKLIRKMPVIGRQIQDKLNKTKEDISKNMSFLKVDQDYVKALPPQG
LSPAAVLEKLKEYSSKDVLWQEGKASGAVYSGEKELTDLLVKAYGDFAWSNPLHPDIFPG
LRKIEAEIVRMACSLFNGGPDSCGCVTSGGTESILMACKAYRELAFENGIKTPEIVAPQS
AHAAFDKAASYFGMKIIRVPLNKMMEVDVRAMRRAISRNTAMLVCSAPQFPHGVIDPIPE
VAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEQPFDFRVKGVTSISADTHKYGYAPKG
SSVVLYSDKKYRRYQFFVATDWQGGIYASPTIAGSRPGGISAACWASLMYFGESGYVEAT
KQIIKTTRFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLFNLMHAKGWNLNQLQFP
PSLHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQATVDRNLVAE
LSSVFLDSLFSTDTVAQGSQMNGSPKPR
Download sequence
Identical sequences W5P8H8
XP_011960615.1.66739 XP_011960616.1.66739 XP_011960617.1.66739 XP_011960618.1.66739 XP_011980853.1.54773 XP_011980854.1.54773 XP_011980855.1.54773 XP_011980856.1.54773 XP_011980857.1.54773 XP_011980858.1.54773 XP_014959898.1.66739 ENSOARP00000006733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]