SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012037225.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012037225.1.66739
Domain Number 1 Region: 28-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.39e-92
Family Calponin-homology domain, CH-domain 0.00000306
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-33
Family Spectrin repeat 0.0001
Further Details:      
 
Domain Number 3 Region: 1635-1788
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-29
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 1527-1682
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-27
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 1005-1159
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-26
Family Spectrin repeat 0.00000604
Further Details:      
 
Domain Number 6 Region: 1845-2000
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-26
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 596-727
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 8 Region: 810-945
Classification Level Classification E-value
Superfamily Spectrin repeat 9.12e-25
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 9 Region: 1224-1370
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-22
Family Spectrin repeat 0.00075
Further Details:      
 
Domain Number 10 Region: 733-849
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-21
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 11 Region: 425-517
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-19
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 12 Region: 518-630
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-18
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 13 Region: 2006-2065
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000489
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 14 Region: 1384-1477
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000222
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012037225.1.66739
Sequence length 2133
Comment PREDICTED: LOW QUALITY PROTEIN: spectrin beta chain, erythrocytic isoform X1 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MTSATEFENVGNQPPYSRINARWDGPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWANSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLREQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFEV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRQFANSLAGVQQQLQAFSTYRTIEKPSKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRDELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELERENYHDQKRITARKDNILRLWDYLQELXRLEKTLDLQKLFQDMLHSIDWMD
GIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITTATLQFAEGPGYQPCDP
QVIRDRVSHLEQCFEELSNTAAGRKAQLEQSKRLCKFFWEMDEAESWIKEKEQIYSSLDY
GKDLTSVLILQRKHKAFEDELRGLDAHLGQIFREAEGMVARKQFGHEQIEVRIKKVSDQW
NELKDLAAFCKKNLQDTENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKH
KDFLEELEESRGVMEHLEQQAQDFPQGFQDSPDVINRLQALRDLYQQVVAQADVRRQRLQ
DALDLYTVFGETDACELWMGEKGKWLAQMEIPDTLEDLEVVQHRFDILDQEMKTLMTQID
GVNLAANSLVESNHPRSAEVKKCQDHLNTRWQDFQTMVSERREAVDSALRVHNYCVDCEE
TGKWIMDKTKVVESTKDLGRDLAGVIAIQRKLSGLERDVAAIQTRLGTLERESQRLMASH
PEQKKDIEQRQAYVEELWQGLKQALKSQEASLGEASQLQAFLQDLDAFQAWLSTTQKDVA
SKDMPESLPEAEQLLQQHAAIKDDIDRHQETYQKVRVSGEKVTHGQTDPEYLLLAQRLDG
LEKGWDALSRMWESRSQVLTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLEAAEA
GIRKFEDFLVSMENNRDKVLSPVDSGNKLVAEGNLFSDKIKEKVQLIEDRHRKNNEKALE
ASELLKDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVAELASH
QGWLENIDVEGKQLMEEKPQFAALVSQKLEALHQLWDELQANTQETARQLSAARSSDMRS
QTQADLNKWIRAMEDQLQSDDLGKDLTSVNRMLAKLKRVEDQVNVRKEELEELFAQMPSL
GEEAGDEDLSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPLAQSTD
YGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLHRGQQLVAAAEIDCQDVEERLGQLQGS
WDTLREAAASRLKHLQEASEAHQYYLDAGEAEAWIGEQEFYVFSDENPQDEESAIVMLKR
HLRQQRAVEEYGRNIKQLAGRAQGLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAEERRRK
LENMYHLFQLKREVDDLEQWIAEKDTVASSSEMGQDFDHVTVLRDKFRDFARETGAIGQE
RVDNVNAIIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLQRYFYT
GSEILGLIGEKHRELPEDVGLDASTAESFHRTHTAFERELHLLGEQVQQFQDVAARLQTA
YAGEKADIIQNNEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWMESIVRQ
IETQEKPRDVSSVELLMKYHQGIRAEIETRSKNFSTCLELGESLLQRQHQASDEIREKRE
QVVSRREEMKEKWEARWERLRMLLEVCQFFRDASVAEAWLIAQEPYLASRDYGHTVDGVE
KLLKRHEAFEKSAASWEERFAALEKPTTLELKERQTPERTEEEPGLQEEEGETAGEAPRG
PHRATTERTSPVSSLSQLSSSWDSLLPETHRPD
Download sequence
Identical sequences XP_012037225.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]