SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012283690.1.87881 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012283690.1.87881
Domain Number 1 Region: 88-182
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-29
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 8-64
Classification Level Classification E-value
Superfamily L27 domain 7.46e-24
Family L27 domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012283690.1.87881
Sequence length 198
Comment PREDICTED: protein lin-7 homolog C [Orussus abietinus]; AA=GCF_000612105.1; RF=representative genome; TAX=222816; STAX=222816; NAME=Orussus abietinus; AL=Scaffold; RT=Major
Sequence
MATIGEPLTLARDVRRAIELLDKLQKGGEVPTTKLAALQKVLQSDFLNAVREVYEHVYET
VDIQGSQDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
RIIPGGVADRHGGLKRGDQLLSVNGVCVEGENHEKAVELLKQAQNSVKLVVRYTPRVLEE
MELRFDKQRAARRRQHVQ
Download sequence
Identical sequences XP_012283689.1.87881 XP_012283690.1.87881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]