SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012361707.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012361707.1.23891
Domain Number 1 Region: 25-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-19
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 2 Region: 146-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012361707.1.23891
Sequence length 388
Comment PREDICTED: neuropilin and tolloid-like protein 1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MGFSARYNFTPDPDFKDLGALKPLPVCEFEMGGSEGIVESIQIMKEGKATASEAVDCKWY
IRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGSSSVEDLKAKFCSTVANDVMLRTGLG
VIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCHSNMCINNTLVCNGLQNCVYPWDENH
CKEKRKTSLLDQLTNTSGTVIGVTSCIVIILIIISVIVQIKQPRKKYVQRKSDFDQTVFQ
EVFEPPHYELCTLRGTGATADFADVADDFENYHKLRRSSSKCVHDHHCGSQLSSTKGSRS
NLSTRDASILTELPTQPGKPLIPPMNRRNILVMKHNYSQDAADACDIDEIEEVPTTSHRL
ARHDKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences ENSNLEP00000011214 XP_012361707.1.23891 XP_012361708.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]