SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012376338.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012376338.1.11602
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 180-411
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-51
Family YWTD domain 0.00000299
Further Details:      
 
Domain Number 3 Region: 783-1040
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-37
Family YWTD domain 0.0000913
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.1e-27
Family YWTD domain 0.0000876
Further Details:      
 
Domain Number 5 Region: 1171-1209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1133-1169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1093-1131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 8 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000497
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000174
Family EGF-type module 0.028
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000521
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1050-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012376338.1.11602
Sequence length 1451
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDGSTRKIVVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEVLGALYSPMDI
QVLSQERQPYLHTQCEEDNGGCSHLCLLSPREPFYACACPTGVQLQGDGRTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLPVDDVRHAIAIDYDPLEGHVYWTDDEARAIRRARLDG
SGAQTLVSTEVHDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
VVHPVMGLMYWTDWGENPKIECAHLDGQARHVLVNTSLGWPNGLALDLPEGKLYWGDAKT
DKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVQASRDVIVDQ
LPDLMGLKAVNVARAVGTNPCAEGNGGCSHLCFFTPRATRCGCPIGLELLSDRRTCIVPE
AFLVFTSRAAIHRISLETSNNDVAIPLTGVKEASALDFDASNNHIYWTDVSLKTISRAFM
NGSSVEPVIEFGLDYPEGVAVDWMGRNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTRGYIYWTEWGGKPRIVRAFMDGTSCMTLVDKVGRANDLTIDYASQRLYWTDLD
TNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQG
HLDFVMDILVFHSSRQDGLNDCVHNNGQCGQLCLAVPGGHRCGCAAHYTLDPSSRNCSPP
TTFLLFSQKCAISRVIPDDQHSPDLVLPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAK
DDGTQPSVLTSPGQGQNPDRQPHDLSLDIYSRTLFWTCEATNTINVHRLSGEAMGAVLCG
DRDRPRAIVVNAERGYLYFTNMQERAAKIERTALDGTEREVLFSTGLVRPVALVVDNALG
KLFWADADLKRIESCDLSGANRLTLEDDNIVQPVGLTVLGSHLYWVDRQQQMVERMEKTT
GYQRTRVQGRIAHLTGLHAVEGVSPEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHL
VLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDRSDEEGCPVCSAAQFP
CGHGQCVDLRLRCDGEADCQDRSDEADCDTVCLPNQFRCASGQCVLIKQQCDSFPDCIDG
SDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGASGPFPH
EYVSGTPHVPLNFIAPGGSQHGPFTGISCGKSMMSSVSLMGGRGGVPLYDRNHVTGASSS
SSSSTKATLYPPILNPPPSPATDPSLYNVEMFYPSSIPAATRPYRPYIIRGMVPPTTPCS
TDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLF
PPPPSPCTDSS
Download sequence
Identical sequences XP_012376338.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]