SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012384375.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012384375.1.11602
Domain Number 1 Region: 608-863
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 17-256
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-52
Family YWTD domain 0.0000017
Further Details:      
 
Domain Number 3 Region: 307-546
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-49
Family YWTD domain 0.00000321
Further Details:      
 
Domain Number 4 Region: 911-1170
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 5 Region: 865-912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000605
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 563-610
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.008
Further Details:      
 
Domain Number 7 Region: 1222-1262
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 1301-1339
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 9 Region: 1263-1299
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 259-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000718
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1180-1233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000315
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012384375.1.11602
Sequence length 1589
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MQTDGTCDWLMLQNGKENATIVVGGLEDAAAVDFVFGHGLIYWSDVSEEAIKRTEFNKTE
SVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIA
LDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINTEIYWPNGLTLDYEERKLYWADAKLN
FIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSN
IFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCK
DGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAI
RRSLIDGSSSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISED
LEEPRAIVLDPMIGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKI
YWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDFVYWTDWQRRSIERVHKRSAE
REIIIDQLPDLMGLKATNVRRIIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELINDM
KTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLK
TISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVW
KDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRR
LYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQ
NRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNN
DNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDS
RQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLD
GRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKP
IALALDSKLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQ
QMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDG
TTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELN
CPVCSESQFQCASGQCIDGVLRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCVGKHKK
CDHNVDCSDKSDEVDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKG
DGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAH
VTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRH
FAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENY
ESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_012384375.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]