SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012387322.1.21590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012387322.1.21590
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.95e-93
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-34
Family Spectrin repeat 0.0000908
Further Details:      
 
Domain Number 3 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-29
Family Spectrin repeat 0.00028
Further Details:      
 
Domain Number 4 Region: 1639-1788
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-29
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 1850-2004
Classification Level Classification E-value
Superfamily Spectrin repeat 1.94e-27
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 1009-1163
Classification Level Classification E-value
Superfamily Spectrin repeat 2.82e-27
Family Spectrin repeat 0.00000441
Further Details:      
 
Domain Number 7 Region: 1531-1686
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-27
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 8 Region: 814-949
Classification Level Classification E-value
Superfamily Spectrin repeat 2.99e-24
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 9 Region: 1228-1374
Classification Level Classification E-value
Superfamily Spectrin repeat 5.69e-23
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 10 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-22
Family Spectrin repeat 0.00034
Further Details:      
 
Domain Number 11 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-18
Family Spectrin repeat 0.00085
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 3.04e-17
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 13 Region: 2010-2069
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000023
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 14 Region: 1388-1481
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000471
Family Spectrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012387322.1.21590
Sequence length 2106
Comment PREDICTED: spectrin beta chain, erythrocytic isoform X2 [Orcinus orca]; AA=GCF_000331955.2; RF=representative genome; TAX=9733; STAX=9733; NAME=Orcinus orca; AL=Scaffold; RT=Major
Sequence
MTSATEVENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIRLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTLQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALREELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELERENYHDQKRITARKGNVLRLWSYLQELLQSRRQRLEKTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVNAIITATLQFTEEPGY
QPCDPQVIQDRVSHLEQCFEELSNTAAGRKAQLEQSKRLWKFFWEMDETESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLDQTFQEAEGMVARKEFGHPQIEARIKE
VSAQWNQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGDVGQDEGATQAL
GKKHKDFMEELEENRGVMEHLEKQAKGFPQEFRDSPDVTNRLQALRDLYVQVVAQADMRR
QRLQDALDLYTVFGETDACELWMGEKGKWLAQMDIPDTLEDLEVVQHRFDILDQEMKTLM
AQIDGVNLAANSLLESSHPRSGEVKKCQDHLNTRWQEFQTMVLERREAVDSALRVHSYCV
DCEETSKWVMDKTKVVESTKDLGRDLTGVIAIQRKLSGLERDVAAIHARVDALRQESQQL
MESHPELKKDIGQRQAYVEELWQALQQALKSQEASLGEASLLQAFLQDLDAFQAWLSTAQ
KDVASKDMPESLPEAEQLLQQHAAIKDDIDRHQNSYQQVKASGEKVIHGQTDPEYLLLGQ
RLDGLDKGWDALHRMWESRSHALTHCFGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLE
AAEARIRKFEEFLVSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNDE
KAQEASVLLRDNLELQNFLQNCKELALWINDKLLTSQDVSYDEARSLHNKWLKHQAFVAE
LASHQGWLENIDAEGKQLMEEKPQFAALVSQRLEALHRLWDELQATTQETTQHLSAARSS
DLRSQTQADLNKWIKAMEDQLRSDDLGKDLTSVNRMLAKLKRVEDQVNVRKVELEELFAQ
MPSLGEEAEHEDLSIEKRFLDLLEPLGRRKKQLESSRARLQISRDLEDETLWVEERLPLA
QSTDHGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLHRGQQLVAAAEIDCRDVEECLGQ
LQVSWDTLRETAARRLQRLRDASEAQQYYLDAGEAEAWISEQEFYVFSDETPQDEEGAIV
MLKRHLRQQRTVEEYGRSIKQLAGRAQSLLSSGHPEGEQIIRLQGQVDKQYAGLKDMAEE
RRRKLENMYHLFQLKREVEDLEQWITEKELVASSPEMGQDFDHVTLLRDKFRDFARETGA
TGQERVDNVNAIIERLIDVGHAEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLQR
YFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATR
LQTAYAGEKADTIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMVRDLLSWMDS
IIRQIETQEKPRDVSSVELLMKYHKGILAEMETRSKNFSACLELGESLLQRQHQASDEIR
EKLQQVVSRRKEMKEKWKARQEQLHMWLEVCQFSRDASVAEAWLIAQEPYLASRDFGHTV
DSVEKLIKRHEAFEKSTAGWAERFAALEKPTTASRRGRRDSRGGSPRSPPCSHRANVPGQ
FPVPSV
Download sequence
Identical sequences XP_012387322.1.21590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]