SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012413561.1.4749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012413561.1.4749
Domain Number 1 Region: 152-263
Classification Level Classification E-value
Superfamily FKBP-like 1.26e-36
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 
Domain Number 2 Region: 258-362
Classification Level Classification E-value
Superfamily FKBP-like 1.71e-33
Family FKBP immunophilin/proline isomerase 0.00037
Further Details:      
 
Domain Number 3 Region: 44-148
Classification Level Classification E-value
Superfamily FKBP-like 1.87e-32
Family FKBP immunophilin/proline isomerase 0.00031
Further Details:      
 
Domain Number 4 Region: 370-444
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000246
Family Calbindin D9K 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012413561.1.4749
Sequence length 455
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP9 isoform X2 [Trichechus manatus latirostris]; AA=GCF_000243295.1; RF=representative genome; TAX=127582; STAX=9778; NAME=Trichechus manatus latirostris; AL=Scaffold; RT=Major
Sequence
MAFKARGWRPPPPPLLLLLLWVTGQAAPVAGLGLGPDAELQIERRFVPDECPRTVRSGDF
VRYHYVGTFPDGQKFDSSYDRDSTFNVYVGKGQLIVGMCVGEKRIITIPPFLAYGEDGDG
KDIPGQASLVFDVALLDLHNPKDGISIENKVVPENCERRSQSGDFLRYHYNGTLLDGSFF
DSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVL
VFDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKT
YNIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLE
LVVGLPEGYMFIWNDEVSPNLFEEIDKDGDGEVLLKEFSEYIHAQVASGKGKLAPGFDAE
MIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL
Download sequence
Identical sequences XP_012413561.1.4749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]