SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012474626.1.20347 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012474626.1.20347
Domain Number 1 Region: 108-230
Classification Level Classification E-value
Superfamily BAG domain 7.46e-25
Family BAG domain 0.0031
Further Details:      
 
Domain Number 2 Region: 42-129
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.83e-17
Family Ubiquitin-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012474626.1.20347
Sequence length 337
Comment PREDICTED: BAG family molecular chaperone regulator 1-like [Gossypium raimondii]; AA=GCF_000327365.1; RF=representative genome; TAX=29730; STAX=29730; NAME=Gossypium raimondii; AL=Chromosome; RT=Major
Sequence
MMRVKTKATGLAPVANGGGGRGESAAHDLELRPGGMLVQKRNPDSDRNSIPPPTIRVRVK
YGSIYHEISISSQATFGELKKMLTVPTGLHHQDQKLLYKDKERDSKAFLDMAGVKDKSKI
VLVEDPISQEKRLLETRKNAKIEKASKSISQVSLEVDRLAGQVSAFETTITKGGKVAEKD
LINSIELLMNQLLKLDGITADGDVKLQRKMQVRRVQKYVETLDMLKIKNAMPSNNGGQME
IQNQHKHTNGQKLAPTQEQKPRHFNWQRLAPVQEQQSSNSIAHLPIHQHHQSASGPVVVT
TNWETFDSSPASLPVPSASTSTANNSVPPKFPWDFFD
Download sequence
Identical sequences A0A0D2PAP7
Gorai.004G121700.1|PACid:26777883 XP_012474626.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]