SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012493193.1.63892 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012493193.1.63892
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.44e-33
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.15e-18
Family Ribosomal protein L11, C-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012493193.1.63892
Sequence length 165
Comment PREDICTED: 60S ribosomal protein L12 [Propithecus coquereli]; AA=GCF_000956105.1; RF=representative genome; TAX=379532; STAX=379532; NAME=Propithecus coquereli; AL=Scaffold; RT=Major
Sequence
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHNGNITFDEIVNIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
Download sequence
Identical sequences B2RYU2 P23358
ENSRNOP00000021725 ENSRNOP00000041462 NP_001102668.1.100692 NP_001102668.1.4139 XP_003785365.1.62490 XP_006227318.1.4139 XP_006256697.1.100692 XP_012493193.1.63892 XP_012495157.1.63892 XP_020145085.1.48125 10116.ENSRNOP00000041462 ENSRNOP00000041462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]