SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012499747.1.63892 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_012499747.1.63892
Domain Number - Region: 39-160
Classification Level Classification E-value
Superfamily E set domains 0.00182
Family Arrestin/Vps26-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012499747.1.63892
Sequence length 336
Comment PREDICTED: vacuolar protein sorting-associated protein 26B [Propithecus coquereli]; AA=GCF_000956105.1; RF=representative genome; TAX=379532; STAX=379532; NAME=Propithecus coquereli; AL=Scaffold; RT=Major
Sequence
MSFFGFGQSVEVEILLNDAESRKRAEHKTEDGKKEKYFLFYDGETVSGKVSLALKNPNKR
LEHQGIKIEFIGQIELYYDRGNHHEFVSLVKDLARPGEITQSQAFDFEFTHVEKPYESYT
GQNVKLRYFLRATISRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNK
SKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVR
GESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR
KSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ
Download sequence
Identical sequences A0A024R3L9 A0A1U7UQX8 A0A2K5EIC7 A0A2K6GYU9 A0A2K6U298 G1RPK0 G3QV91 H2NFX1 K7A160 Q4G0F5 U3BWN4
ENSPPYP00000004656 ENSP00000281187 ENSP00000434162 ENSGGOP00000006655 ENSGGOP00000006655 ENSP00000281187 ENSPPYP00000004656 ENSNLEP00000015164 ENSP00000281187 ENSP00000434162 gi|16418381|ref|NP_443107.1| 9598.ENSPTRP00000007686 9600.ENSPPYP00000004656 9606.ENSP00000281187 GO.35430 NP_443107.1.87134 NP_443107.1.92137 XP_002822761.1.23681 XP_003281047.1.23891 XP_003943002.1.74449 XP_008067732.1.4292 XP_008067733.1.4292 XP_008971507.1.60992 XP_012304579.1.9421 XP_012499747.1.63892 XP_012595064.1.48125 XP_016817035.1.37143 XP_018891947.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]