SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012511239.1.63892 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012511239.1.63892
Domain Number 1 Region: 573-828
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 1.29e-54
Family YWTD domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 331-530
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-40
Family YWTD domain 0.00000982
Further Details:      
 
Domain Number 4 Region: 876-1135
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 5 Region: 830-877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1266-1304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 1187-1227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 528-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000136
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 9 Region: 1228-1264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000658
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1145-1198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000026
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012511239.1.63892
Sequence length 1554
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Propithecus coquereli]; AA=GCF_000956105.1; RF=representative genome; TAX=379532; STAX=379532; NAME=Propithecus coquereli; AL=Scaffold; RT=Major
Sequence
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGRENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINTE
IYWPNGLTLDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVKAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEINHTITNMLVYLLGSNPCAEENGGC
SHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLT
GVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNL
YWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMD
GSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLT
QYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGH
CSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIIL
PIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDL
SIDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQER
SPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVL
EDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGQEGRTKVQARIAQLSDIHAVKELNL
QEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTG
EIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDE
KNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIG
VIVTIFVSGTIYFLCQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGM
SRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYT
MEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSAATAKGYTSD
LNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_012511239.1.63892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]