SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012520294.1.63892 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012520294.1.63892
Domain Number 1 Region: 642-897
Classification Level Classification E-value
Superfamily YWTD domain 1.18e-55
Family YWTD domain 0.0000059
Further Details:      
 
Domain Number 2 Region: 30-290
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-54
Family YWTD domain 0.00000166
Further Details:      
 
Domain Number 3 Region: 341-571
Classification Level Classification E-value
Superfamily YWTD domain 1.19e-50
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 4 Region: 944-1199
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-37
Family YWTD domain 0.0000641
Further Details:      
 
Domain Number 5 Region: 1332-1368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000733
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1294-1330
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1254-1292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 597-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000882
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 900-951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000405
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 295-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1211-1263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000931
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012520294.1.63892
Sequence length 1638
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Propithecus coquereli]; AA=GCF_000956105.1; RF=representative genome; TAX=379532; STAX=379532; NAME=Propithecus coquereli; AL=Scaffold; RT=Major
Sequence
MEAPPPRPPPPSPLLLLALCCSLAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVSGLE
DAAAVDFQFSKGAVYWTDVSEEAIKQTFLNQTGAAVQNVVISGLVSPDGLACDWVGKKLY
WTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDG
STRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFAL
TLSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDIQVLSQERQPSFHTQCEEDN
GGCSHLCLLSPREPFYACACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFT
DIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAV
DWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPK
IECANLDGQERHVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLED
KLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTN
PCAEGNGGCSHLCFFTPRATRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETN
NNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGM
AVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGK
PRIVRAFMDGTNCMTLVDKVGRANDLTIDYTDQRLYWTDLDTNMIESSNMLGQERVVIAD
DLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGL
NDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKCAISRMIPDD
QHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRARDDGTQPFVLASPSQGQNPD
RQPHDLSIDIYSRTLFWTCEATNTINVHRLSGDAMGVVLRGDRDKPRAIVVNAERGYLYF
TNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSG
ANRLTLEDANIVQPVGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHG
VEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQ
FACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADC
QDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDTPGH
SSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFITPGGS
QHGPFPGISCGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPS
PATDPSLYNMDMFYSSNIPAAARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYY
LDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPTARAHPGCAILQQPQRRLRVTVSLEADPR
FRIRQVHGKRMRLSRLTD
Download sequence
Identical sequences XP_012520294.1.63892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]