SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012693708.1.3086 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012693708.1.3086
Domain Number 1 Region: 21-283
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-55
Family YWTD domain 0.00000147
Further Details:      
 
Domain Number 2 Region: 636-891
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-55
Family YWTD domain 0.00000295
Further Details:      
 
Domain Number 3 Region: 335-573
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-51
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 4 Region: 939-1200
Classification Level Classification E-value
Superfamily YWTD domain 1.1e-40
Family YWTD domain 0.0000328
Further Details:      
 
Domain Number 5 Region: 1251-1290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 6 Region: 1329-1367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 894-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000061
Family EGF-type module 0.017
Further Details:      
 
Domain Number 8 Region: 592-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000486
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 9 Region: 1291-1326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 10 Region: 1208-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family EGF-type module 0.017
Further Details:      
 
Domain Number 11 Region: 290-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000004
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012693708.1.3086
Sequence length 1629
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X1 [Clupea harengus]; AA=GCF_000966335.1; RF=representative genome; TAX=7950; STAX=7950; NAME=Clupea harengus; AL=Scaffold; RT=Major
Sequence
MGAVLRSLLLCSFCLLIRGVPLLLYANRRDLRLVDASQARANATVVVSGLEDAAAVDYVY
SQGLIYWSDVSEEAIKRTVYNHSGGPNGLQVTVVSGLASPDGLACDWLGKKLYWTDSETN
RIEVAELDGTLRKVLFWQDLDQPRAIAVDPERGYMYWTDWGEIPKIERAGMDGTSRQMII
DSDIYWPNGLTLDYDEKKLYWADAKFNFIHRTNLDGTLREVVVGGELPHPFALTLYERTL
FWTDWTTHSVHSCNKQTGDDRREIHSNIFSPMDIHVFSQKRQPTVVPTHCSVKNGGCSHL
CLLSPNEPFYQCACPTGVQLLGNNKTCRDGATQLLLLARRTDLRQISLDTPDFTDIIMPA
EDIRHAIAIDYDPIEGYVYWTDDEVRAIRRSYLDGSDAQVVVTSQVSHPDGIAVDWVARN
LYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEIPKIERAAL
DGTDRVVMVNTSLGWPNGLALDYDEKKIYWGDAKTDKIEVMNMDGSSRRILVEDKLPHIF
GFTLLGDWIYWTDWQRRSIERVHKHTADRKTIIDQLPDLMGLKATYVHETFGTNACADNN
GGCSHLCLYRPQGVACACPIGLELIADMSTCIVPEAFLLFSRHTDIRRISLETNNNNVAI
PITGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSSLEHVVEFGLDYPEGMAVDWLG
KNLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGRPKIDRA
AMNGMGRITLVANVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGGDREVIAEDLPHPF
GLTQYQDYIYWTDWSLRSIERANKTSGQNRTVIQGHLDYVMDILVYHSSRQGGWNACAST
NGHCSHLCLAVPISSYVCGCPAHYSLNYDNKTCSAPTSFLLFSQKTAINRMVIDEQQSPD
IILPIHSLKNVRAIDYDPLDKHLYWIDSKQNVIRRAQEDGNQSMTIVSNSLGGPNLGLQP
FDLSIDIYSRYIYWTSEVTNVINVTRTDGTRVGVVLRGEQDKPRAIVVNPERGYMYFTNL
QERSPKIERAALDGTEREVLFFSGLGKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANR
IVIEDSNILQPVGLTVFGDHLYWIDRQQQMIERIDKTTREGRTKIQARIAALSDIHAVHE
LDMNEYSKHPCTSDNGGCSHICIVKGDGSTRCSCPVHLMLLQDELTCGEPPTCSPEQFQC
MSGEVYCIPQAWRCDGYAECDDNSDEHNCPVCSEIEFQCDSRQCVDLALRCNGEINCQDR
SDEDKCEIRCAPDQFSCANGPCIGKHKKCDHNMDCTDNSDELGCYPTEEPSPQPTNTIGS
IVGVVMALFVVGAVYFVCQRVLCPQMKDDGETMTNDFVVTGPSSVPLGYVPHPNSLSGSL
PGMSRGKSVIGSLSIMGGSNGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRS
QYTMEFGYSSNSPSTHRSYRVYSYRHFAPPTTPCSTDVCDSDYTPGRRAPHHHRPPTGVS
TGAGAAFAKGYASDLNYDSEPFPPPPTPRSQYMSAEENNCESCPPSPYTERSYSHHLYPP
PPSPCTDSS
Download sequence
Identical sequences XP_012693708.1.3086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]