SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012700166.1.39314 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012700166.1.39314
Domain Number 1 Region: 26-87
Classification Level Classification E-value
Superfamily F-box domain 0.0000000733
Family F-box domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012700166.1.39314
Sequence length 456
Comment PREDICTED: uncharacterized protein LOC101755462 [Setaria italica]; AA=GCF_000263155.2; RF=representative genome; TAX=4555; STAX=4555; NAME=Setaria italica; strain=Yugu1; AL=Chromosome; RT=Major
Sequence
MAPPRRAAAPPHSTKGWLSRCRRPPRNRKGSSRRAVDPLATMPDDLLFDAIFSLVFSDAG
DVARCAAVCRRWGRIVAAREAAILRALPPPDRFLPHLALGFFHGGQHDLSSTRRRQLAAQ
AQTDPCFVPTPSASVLLGSPFPGLPEGGDGGGLFHYARPVASRGGRVVFELRRKTRADGV
ALSVCNPMTGDVALVPPLAGDDFPGHDYMCAVLTADDLDNDAQQGSSFFSLVLVYNRRSF
TALRCYTSDDAGGGGGWGPEFRKPGTQISGHVLQRLGPAVVLRGVVYWPIMVAAALAVRL
DGGAAAAVMDVHVVPYTIRDTLPDWRLLGTTPDGRLSYVSAGLMGGELLSFGVETLDVSA
AAGAEWERGDTSVLTQLTVPMLSKFELKMRWLGEKSGTLFFTIGEGCSTSGAFAVNLATG
SVDKLADGVECNSWRSLYGYEMDPTALLASIAARFN
Download sequence
Identical sequences K3YSC3
Si017167m|PACid:19689439 XP_012700166.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]