SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012710849.1.37407 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012710849.1.37407
Domain Number 1 Region: 481-742
Classification Level Classification E-value
Superfamily YWTD domain 1.18e-51
Family YWTD domain 0.00000471
Further Details:      
 
Domain Number 2 Region: 180-413
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-51
Family YWTD domain 0.00000192
Further Details:      
 
Domain Number 3 Region: 790-1044
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-37
Family YWTD domain 0.0000794
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-26
Family YWTD domain 0.0000632
Further Details:      
 
Domain Number 5 Region: 1176-1214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 1098-1137
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 746-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000471
Family EGF-type module 0.026
Further Details:      
 
Domain Number 8 Region: 1138-1173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 9 Region: 134-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 10 Region: 437-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 11 Region: 1056-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000053
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012710849.1.37407
Sequence length 1480
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X1 [Fundulus heteroclitus]; AA=GCF_000826765.1; RF=representative genome; TAX=8078; STAX=8078; NAME=Fundulus heteroclitus; AL=Scaffold; RT=Major
Sequence
MYWTDWGEEPRIERAGMDGSSRKVIVNENIHWPNGLTIDIVQEKLYWADAKLSFIHRANL
DGSAREAVVEGTLTHPFALTLSKETLYWTDWQTRSIHACNKHSGEKTREILSGIYSPMDI
QVLEPYRQPYIKTPCSNYNGGCSHLCLLSPVEPFYSCACPTGVQLKADGKTCKPGAEQVL
LLARRTDLRRISLDLPDFTDIVLQVDDIRHAIAIDYDPVEGFVYWTDDEVRAIRRSHIDG
SNAMILVTMDISHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISEDLDEPRAI
VLDPVNGFMYWTDWGQHPKIERANLDGTDRVVLLNNSLGWPNGLAIDYKAGKLYWGDAKT
DKIEVINVDGSNRQTLLEDKLPHIFGFTLLGEYIYWTDWQSRSIERVHKATAVRDIIIDQ
LPDLMGLKATKVTETHGTNGCAENNGGCSHLCFWCELVVRCACPMGLELLSDLRTCVVPE
AFLLFTNRDSIRSISLGTNSNDVAIPLTGVKEASALDFDVSERRIYWTDIQAKTISRAYM
NGSSVEHVIEFGLGYPEGMAIDWMGRNVYWADTGTNRIEVARLDGQYRQVLVCKDLDNPR
LLDNPRSLALDPAHGYMYWTEWGGRPRIARAYMDGNTIITLVDKVGRANGLTIDYVDQRL
YWTDLDTCMIESTNMQGLQREIIVDDLPHPFGLTQYRDFIYWTDFNLRSIERADKRSGLN
RTVVLQGQLELMLDILVFHSSRQDGTNECSQNNGNCAHLCLATPAGAQCRCAFHYTLNPD
GRNCSSPLSFLLFSQKASISRMVLGDQSPDIILPIHVMRNVRAVSYDPLERLVYWLDGRQ
NIRRARDDGTMSSIIVSSPSQPVDNQLHDLSLDPYSRHIYWTCETTNTITVQKMDGHIVG
VVVKDDTDKPRAIVVNAEKGYMYFTTVQEHSAKIEGASLDGTERESLFSTGLIRPVALAL
DNKLGKLFWVDADLKRIESSDLTGANRIVLQDSNILLPMGLTVLGDHLYWIDRQQQMIER
VDKLTGEGRTRIQGQISYLTSIHAAEEMDPQELASHPCSRDNGGCSHICIAKGDGTSTCS
CPMHLVLLQDLLHCGEPPTCSTEQFTCSTGEIGCIPMAWRCDRYPECDDGSDEENCPICS
SFQFQCDEGSCIDAQKRCDGEPDCPDKSDEHECDTVCPPNQFRCGDNHCITKKQQCDNYS
DCLDGSDELACEYISPSSSFIPSNETTNPIGPVIAIILLMFVMGGACFICQRVVCRRYKG
PNGTFPHEYISGTPHVPLNFISPSSSQHGTYQGISCGKSTMSSVSLMGSSSSGAPLYDRN
HVTGASSSSSSSTKGAFYPKILNPPPSPATDRSLYNTEIFYSSNSPSTTRSYRTYHPVRG
GAPPTTPCSTDVCDSDYTPHHPPAGLPLSAGRWKASGHSSHGKPNKYYMDLNSDSDPYPP
PPTPRSQYMSAEESCPPSPSTERSYFHLCPPPPSPCTDSS
Download sequence
Identical sequences XP_012710849.1.37407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]