SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012788843.1.94378 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012788843.1.94378
Domain Number 1 Region: 600-855
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 13-272
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-54
Family YWTD domain 0.00000132
Further Details:      
 
Domain Number 3 Region: 323-515
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-40
Family YWTD domain 0.0000088
Further Details:      
 
Domain Number 4 Region: 903-1162
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-39
Family YWTD domain 0.0000468
Further Details:      
 
Domain Number 5 Region: 857-904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1293-1331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 1214-1254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000126
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 556-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000141
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 9 Region: 1255-1291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 275-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000562
Family EGF-type module 0.009
Further Details:      
 
Domain Number 11 Region: 1172-1225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000311
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012788843.1.94378
Sequence length 1581
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Sorex araneus]; AA=GCF_000181275.1; RF=representative genome; TAX=42254; STAX=42254; NAME=Sorex araneus; AL=Scaffold; RT=Major
Sequence
MGHEKAPRDRAAPLLLYANRRDLRLVDATNGRENATIVVGGLEDAAAVDFVFGHGLIYWS
DVSEEAIKRAEFNRTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSL
RKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRYIIINTEIYWPNGLT
LDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSIL
ACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGSDNGGCSHLCLMSPVKPFYQC
ACPTGVRLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYD
PVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIE
VTRLNGTMRKILISEDLEEPRAIVLDPMIGYMYWTDWGEIPKIERAALDGSDRVVLVNTS
LGWPNGLALDYDEGKIYWGDAKTDKIEELSLDEDFQCLYLYPSGDLHKRSAEREIIIDQL
PDLMGLKATNVHRIFGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEA
FLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMN
GSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRA
LALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDT
NLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGH
LDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAP
TTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNVIRKA
QEDGGQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSIGVVL
KGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSR
LGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDM
TGRESRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPM
HLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQ
FQCASGQCVDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCS
DKSDELDCYPTEEPAPQATNTVGSVIGVIITILVSGTIYFICQRMLCPRMKGDGETMTND
YVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSS
SSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPC
STDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPY
TERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_012788843.1.94378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]