SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012848196.1.32330 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012848196.1.32330
Domain Number 1 Region: 223-367
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.95e-17
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 49-185
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000178
Family BTB/POZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012848196.1.32330
Sequence length 587
Comment PREDICTED: regulatory protein NPR1-like [Erythranthe guttata]; AA=GCF_000504015.1; RF=representative genome; TAX=4155; STAX=4155; NAME=Erythranthe guttata; cultivar=IM62; AL=Scaffold; RT=Major
Sequence
MDSRTAFCDSNDVSGGSSSTCCAATATDSSLSPSPVQLPADVAAIKRLSDTLESVFLSPS
DSDFFADARLVAASGKEIPVHRCILSARTPFFKNLFASRERNAKLKLKELMKEYDVGYDA
LVTVLAYLYSGKIRASPKDVCVCVDDECSHLACRPAVAFMVEVLYASFIFQISELVARFQ
NSLMGILDKTTTDDVLMVLSVANMCGTVCGSLLARAIEIVVKSDLDVITLEKSLPQHIIK
QINESRIALGLLSPENSTCPDKHVKRIHRALESDDVELVRMLLKEERTNLDDAYALHYAV
AYCDSKTTAELLDLAIADINQRNPRGYTVLHVAAMRKDPKIIVSLLTKGARPSDLTSDGR
KALQISKRLTRAIDYYGSTEEGKSTPKDRLCIEILEQAERRDPLPGEASMSLALAGDDLR
TKLLYLENRVALAKLLFPMEAKVAMDIAQVDGTSEFHLSGIHKNQAGSQRTEVDLNEAPF
KIKEEHLNRLRALSKTVELGKRFFPRCSAVLNKIMDRDDYPDIAQMGNGSPEECPLKRQR
RMEIEEVLSKAFTEDKEEIDRTINLSTSSSSSSVGIMRPNGMLPFKN
Download sequence
Identical sequences A0A022QKB4
XP_012848196.1.32330 mgv1a003409m|PACid:17674843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]