SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012852720.1.32330 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012852720.1.32330
Domain Number 1 Region: 29-205
Classification Level Classification E-value
Superfamily MIR domain 1.07e-58
Family MIR domain 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012852720.1.32330
Sequence length 214
Comment PREDICTED: stromal cell-derived factor 2-like protein [Erythranthe guttata]; AA=GCF_000504015.1; RF=representative genome; TAX=4155; STAX=4155; NAME=Erythranthe guttata; cultivar=IM62; AL=Scaffold; RT=Major
Sequence
MAVSFFALAIFMLLTLDSDFSSAPVSAASEGVQITYGSVIKLMHEKTKFRLHSHDVPYGS
GSGQQSVTGFPEVDDSNSYWIVRTTPKSSAKQGDTIKSGTVIRLQHMKTRKWLHSHLHAS
PISGNLEVSCYGGDGQSDTGDYWRLEIEGNGKTWRQDQRVRLHHVDTNGYLHSHDKKYTR
IAGGQQEVCGVAEKRADNVWLAAEGVYLPVAESK
Download sequence
Identical sequences A0A022QBH6
mgv1a013643m|PACid:17694603 XP_012852720.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]