SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012853330.1.32330 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012853330.1.32330
Domain Number 1 Region: 112-232
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-30
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012853330.1.32330
Sequence length 522
Comment PREDICTED: auxin response factor 17 [Erythranthe guttata]; AA=GCF_000504015.1; RF=representative genome; TAX=4155; STAX=4155; NAME=Erythranthe guttata; cultivar=IM62; AL=Scaffold; RT=Major
Sequence
MSNFSSSSSAVATASEVDASIWRAVAGACVQIPPPNSFVYYFPQGHLEHCSFSTAFINSF
NFALGRPFIYCQVLSIRFFSNHLSDQVFVKITLQPINTYGPCPVSNAGGDRENNQGDVVL
FSKILTPSDANNGGGFSVPRSCADMIFPPLDFAADPPVQNLTLKDTNNNAWEFRHIYRGT
PRRHLLTTGWSKFVNAKRLVAGDSAVFMRKQSTDELYIGVRRAQRFGGIEGQNGGEALRA
IENAVKGMAFEVLYCPTFGSPDFVVKAEKVCEATRTNWTAGMRVKMAVEADDSSRLTWSS
GTIAAVSCPNTGPWCGSPWGLLQMTWDEPESMRNVNRVSPWQVEYLDPTLMLNPNFPPLK
KLKLLSYSDMLLSAGEGEIPFPTAEFNSPLFNASIQGARLDPVYIPTTTTTNSQVSKEIP
DKNEGEPERETVSTVLSIGSSYSDKDNVSPPSQSSVASATKLVRENSFQLFGQIIQMPQP
GEDGACCSNAVSEENPVIDHQLPSPSARVQQQQRFRRPSDKS
Download sequence
Identical sequences A0A022Q7N3
mgv1a004523m|PACid:17674410 XP_012853330.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]