SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012868653.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012868653.1.60039
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily POZ domain 1.79e-16
Family Tetramerization domain of potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012868653.1.60039
Sequence length 233
Comment PREDICTED: BTB/POZ domain-containing protein KCTD11 [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MLGAMFRADTPVPPNVNPQAGGQYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAE
ADFYQIQPLLDALRELEASQGSPAPTAALLHADVDVSPRLVHFSARQGPHHYELSSVQVD
TFRANLFCTDAECLSALRTRFGVANGDRAEGGPHFHLEWAPRPAELPEGEYGRLGLQPLW
AGGPGDRRREVVGTPGFLEEVLRVALEHGFRLDSVFPDPEDLLNSRSLRFVRH
Download sequence
Identical sequences A0A1S3EW60
ENSDORP00000000303 ENSDORP00000000303 XP_012868653.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]