SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012873490.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012873490.1.60039
Domain Number 1 Region: 17-340
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.13e-117
Family Aldose 1-epimerase (mutarotase) 0.0000000000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012873490.1.60039
Sequence length 342
Comment PREDICTED: aldose 1-epimerase [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MVSVTRTAFGELPSGAGPVEKFRLQSDLLKVDLISWGCTITALEVPDRQGKASDVVLGFA
ELAGYLQKQPYFGAVVGRVANRIAKGAFTLDGKEYRLAINREPNSLHGGLRGFDKVLWTP
QVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELVINYRAQTSHTTPVNLTNHSYFN
LAGQGSPNIYDHEVTIEADAFLPVDETLIPTGNVAPVQGTAFDLRKPVELGKHLQKFGIN
GFDHNFCLKGSKEKHFCARVQHPGSGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
HSGFCLETQSWPDAVNQPHFPPVLLRPGEEYNHTTWFKFSVA
Download sequence
Identical sequences A0A1S3FB66
ENSDORP00000008085 XP_012873490.1.60039 ENSDORP00000008085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]