SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012876605.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012876605.1.60039
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-56
Family YWTD domain 0.00000656
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-50
Family YWTD domain 0.00000259
Further Details:      
 
Domain Number 3 Region: 783-1044
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-39
Family YWTD domain 0.0000791
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-28
Family YWTD domain 0.0000785
Further Details:      
 
Domain Number 5 Region: 1175-1211
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1137-1173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1097-1135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000132
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000153
Family EGF-type module 0.023
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000521
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1054-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012876605.1.60039
Sequence length 1455
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDGSARKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILSSLYSPMDI
QVLSQERQPPFHTQCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDG
SGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGENPKIECANLDGRERHVLVNTSLGWPNGLALDLQEGKLYWGDAKT
DKIEVINVDGTERQTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQ
LPDLMGLKAVNVAKVFGTNPCAEGNGGCSHLCFFTPQATKCGCPIGLELLSDMKTCIVPE
AFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGRNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGQERVVIADDLPHPFGLTQYSGYIYWTDWNLHSIERADKTSGQNRTLIQG
HLDFVMDILVFHSSRQDGLNDCTHNNGQCGQLCLAVPGGHRCACASHYTLDPSSRNCSPP
STFLLFSQKCAISRMIPDDQHSPDLVLPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAK
DDGTQPFVLTSPGQSQGQGQSPDRQPHDLSIDIYSRTLFWTCEATNTINVLRLDGDAMGV
VLRGDRDKPRAIAVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVD
NSLGKLFWVDADLKRIESCDLSGANRLTLEDSNIVQPVGLTVLGRHLYWVDRQQQMIERV
EKTTGDKRTRVQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSC
PVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSA
AQFPCARGQCVDVRLRCDGEADCQDRSDEADCDAVCLPNQFRCASGQCVLIKQQCDSFPD
CVDGSDELMCEITKPSSDDIPAHSSAIGPVIGILLSIFVLGGVYFVCQRVVCQRYAGANG
PFPHEYVSGTPHVPLNFIAPGGSQHGPFTGISCSKSMMSSVSLVGGRGGMSLYDRNHVTG
ASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDTFYSSNIPATTRPYRPYVIRGMAPPT
TPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSY
CHLFPPPPSPCTDSS
Download sequence
Identical sequences A0A1S3FJW4
XP_012876605.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]