SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012889006.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012889006.1.60039
Domain Number 1 Region: 48-85
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000102
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 2 Region: 119-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012889006.1.60039
Sequence length 262
Comment PREDICTED: CD320 antigen isoform X2 [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MARGGERRTVALGLVLRLLLGFGLGLEAAPTSVRTQTPIQAPGLGSGSCPSTSFQCGTNG
YCVPLTWRCDGDRDCADGSDEEECRIEPCAQDGHCPPPSALPCSCDNLSGCPGGIRAPHN
CSQGLCREDERRCAATEACVPHTWLCDGHPDCPDASDELGCETSLDTNETFQEGSTTPVA
TPVTLESITSLQNTTATLTGNQAGSPSAYRVVVAAGVLSAILVAATLLLLFRLRARGRLP
PMRLLVAVKESLLLSERKTSQL
Download sequence
Identical sequences A0A1S3GJN2
XP_012889006.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]