SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012902805.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012902805.1.14098
Domain Number 1 Region: 389-683
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.98e-56
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 2 Region: 61-313
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.11e-34
Family WD40-repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012902805.1.14098
Sequence length 1307
Comment PREDICTED: WD repeat-containing protein 17 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAWMTYISNWFEQDDWYEGLQRANMSQVRQVGLLAAGCQPWHKDVCAANGDRFAYCATLA
IYIYQLDHRYNEFKLHAIMSEHKKTITAISWCPHNPDVFASGSTDNLVIIWNVAEQKVLA
KLDNTKGTPASLSWCWNAGDAVAFVSHRGPLFIWTISGPESGVTVHKEAHSFLSDVCVFR
WHTQKKGKIVFGHIDGSLSIFQPGNKSQKHVLRPESLEGTDEEDPVTAVEWDPLSTDYLL
VANLHFGIRLLDSESLYCITTFNFPSAAASVQCLAWVPSAPGMFVTGDSQVGVLRIWNVS
RTTPIDNFKLKKTGFHCLHVLNSPPRKKFLAQSPTKNHYMSSTSEAVPQPTLTQNQAFSL
PPGHAVCCFLDGGVGLYDLGAKKWDFLRDLGHVETIFDCKFKPDDPNLLATASFDGTIKV
WDINTLTAVYTSPGNEGVIYSLSWAPGDLNCIAGATSRNGAFIWDVRKGKMVQRFNEHGK
NGIFCVAWSHKDSKRIATCSGDGFCIIRTIDGKVLHKYKHPAAVFGCDWSQNNKDMIATG
CEDKNVRVYYVATSSDQPLKVFSGHTAKVFHVKWSPLSEGILCSGSDDGSVRIWDYTQDA
CINILSGHTAPVRGLMWNTEIPYLLISGSWDYTIKVWDTREGTCLDTVYDHGADVYGLTC
HPSRPFTMASCSRDSTVRLWSLTPLITPLLINILADRSWEEIIGNTDHAIEQGSPPLLCG
KVSRDIKHEIEKLTGNPRAKKLRWFSECLSPPGGSDNLWNLVAVIRGQDDSLLPQNYCKG
IMHLKHLIKFRMSEAQELTTVKMSKFGGGIGVPTKEERLKEAADIHLRLGQIQRYCELMV
ELGEWDKALSVAPGVSVKYWKKLMQRRADQLIQEDKDEVIPYCIAIGDVKKLVDFFMSRG
QLKEALLVAQAACEGNMQTLHVSTPKGSSSSDDIYKEDFNELLHKVSEELAEWYFRDGRA
VLAACCQLAVDNTERAMAYLIRGNELELAVCVGTTLGEAAAPGTHYALELLARKCMMIPT
WNLAADLLLMTPDNELQLVKLCAFYPGCTEELNDLREKCKLPTVEECMQLAETAHADGNI
FETVKYYLLSQEPEKALPIGIDFIKEYITSSNWTLDTIYPVLDLLSYIRTEKLVLHTCTK
ARNELLILCGYIGALLAIRRQYQSIVPALYEYTSQLLKRRAVSVPLKIEHLSEELDAWRA
CTQSVSRSSEESAYTPPSDSQKMVYATLLKRLEQEPLRGIVGPDYVTGSNLPSHSDIHIS
CLTGLKIQGPVYFLEDGKSTISLNDALMWAKVNPFSPLGTGIRLNPF
Download sequence
Identical sequences M3YKU9
XP_012902805.1.14098 ENSMPUP00000011956 ENSMPUP00000011956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]