SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012911758.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012911758.1.14098
Domain Number 1 Region: 340-594
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-72
Family Protein kinases, catalytic subunit 0.000000000476
Further Details:      
 
Domain Number 2 Region: 143-255
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-30
Family SH2 domain 0.000000457
Further Details:      
 
Domain Number 3 Region: 7-132
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-29
Family SH2 domain 0.00000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012911758.1.14098
Sequence length 616
Comment PREDICTED: tyrosine-protein kinase ZAP-70 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
SQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKDACPNTSASAEAAAPTLPAHPSTLTHAHRRIDTSSDGYTPEPARLVSSE
KAQSMPMDTSVYESPYSDPEELKDKKLFLKRDNLLMADIELGCGNFGSVRQGVYRMRKKQ
IDVAIKVLKHSTEKTDKDEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLH
KFLLGKKEDIPISNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLS
KALGADDSYYTARSAGKWPLKWYAPECFNFRKFSSRSDVWSYGVTMWEAFSYGQKPYKKM
KGPEVINFIEQGKRMECPAECPPEMYALMSDCWIYKWEDRPDFQAVEQRMRTYYYSVASK
AEGPPGCGKGPEAASA
Download sequence
Identical sequences M3YIR3
ENSMPUP00000011220 XP_004752969.1.14098 XP_012911757.1.14098 XP_012911758.1.14098 XP_012911759.1.14098 XP_012911760.1.14098 ENSMPUP00000011220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]