SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012916114.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012916114.1.14098
Domain Number 1 Region: 47-525
Classification Level Classification E-value
Superfamily Sema domain 8.11e-113
Family Sema domain 0.00000183
Further Details:      
 
Domain Number 2 Region: 1084-1345
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-76
Family Protein kinases, catalytic subunit 0.0000000143
Further Details:      
 
Domain Number 3 Region: 684-772
Classification Level Classification E-value
Superfamily E set domains 1.22e-16
Family E-set domains of sugar-utilizing enzymes 0.057
Further Details:      
 
Domain Number 4 Region: 525-572
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000022
Family Plexin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 770-864
Classification Level Classification E-value
Superfamily E set domains 0.000000028
Family Other IPT/TIG domains 0.049
Further Details:      
 
Domain Number 6 Region: 569-628
Classification Level Classification E-value
Superfamily E set domains 0.000000255
Family Other IPT/TIG domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012916114.1.14098
Sequence length 1399
Comment PREDICTED: macrophage-stimulating protein receptor isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MELLPLPSQPSLLLLLLVLVLPPLLTRGSWQCPRTPFAALRNFDVEYEVPSFSAGGPVQA
VTTYEGGEDGSAVFVATRNRLYVLGPGLEPVESLATGPIGDPGCQTCAACGPGPHGPQGD
TDAQVLVLEPALPALVSCGSSLHGRCFLHELEPGGTALHLAPPICLFSAHHNQPEECPDC
VASPLGTVVTVVEQGHASYFYVASSLDETVAASFSPRSVSIRRLKADASGFAPGFAALSV
LPQYLASYPIEYVYSFRAGAFVYFLTVQRASVTAAPGALHTRLARLNAAEPELGDYRELV
LDCRFAPKRRRRGAAEGGQPYPVLRAAHTAPVGSRLATELSIREGQEVLFGVFRARRDSS
PGVNPNSVVCAFPIDLVDTVIEQGVKRCCESPVPQGMRRGLDFFQSHSFCPNPPGQEAPS
LNTSCHHFPLLVHGSLSRVDLFNGLLGPVQVTALHVTRLDNVTVAHMGTADGRILQVELA
RSLNYLLYVSNFSLGCCGQPMRPDVSRLGDHLFFASGDQVFQVPIQGPGCHHFLTCGSCL
RAQRFMGCGWCGDTCGRQKECPGSWQQDHCPPELTEFYPQSGPRRGSTRLTLCGSNFYPH
PPEPVREGTHQVTVGQSPCRLLPKDSSNPRPVFQKDFVEELECEVEPLDMQLAGPANISL
TVSNMSPGKHFRVYGTSTLQGFSFMEPVLRAVKPLFGPRAGGTRLTLEGEGLSLGTSQAV
LVNGTECPLERVSEGQLLCTTPPAAATASVPIHLQVGGAVVPGSWNFSYLEDPVVLGISP
NCGYIGSQVTVQGQHLTSAWRLVLSFHDGLRAVENSCERQLPEQQSCRLPEYVVRSPQGW
VTGNLSAQGDGAAGFILPGFRFLPPPHPPSTDLAPLKPEEHAVKFEYIGLGAVADCVDVN
VTMDGKSCQHELRGDVVICPLPPSLQLDMDGVPLQVCVDGECHILGRVVRPGPEGVPQGL
LLGLLLALLLLVAALAAALIFSYWRRKQLGDLASLDRMAGAMPLPVLRSGSDYRNGLAAP
DADGLDGPDSTSREHKASSSDSGDGSCVPLLRTASIQLGDLDSALLAEVKDVLIPHERVV
THSDRVIGKGHFGVVYHGEYIDEDQNRIHCAIKSLSRITEGQEVEAFLREGLLMRGLRHP
NVLALIGIVLPPEGLPRVLLPYMRHGDLLRFIRSPQRNPTVKDLVSFGLQVARGMEYLAE
QKFVHRDLAARNCMLDESFTVKVADFGLARDVLDKEYYSVRQHRHARLPVKWMALESLQT
YRFTTKSDVWSFGVLLWELLTRGAPPYPHMDPFDLTQFLAQGRRLPQPEYCPNSLYAVML
RCWAADPTVRPTFKVLVEEVEHVAARLLGDHYVQLPAAYVNLGASTSDEASKPPEQSQTT
PVHRSTARPRPLSEPPQPT
Download sequence
Identical sequences M3YPD7
ENSMPUP00000013195 XP_012916114.1.14098 ENSMPUP00000013195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]