SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012929867.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012929867.1.39548
Domain Number 1 Region: 231-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-81
Family Protein kinases, catalytic subunit 0.000000000199
Further Details:      
 
Domain Number 2 Region: 122-265
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-39
Family SH2 domain 0.0000014
Further Details:      
 
Domain Number 3 Region: 54-172
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-23
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012929867.1.39548
Sequence length 509
Comment PREDICTED: tyrosine-protein kinase Lck isoform X2 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MGCSCSSNPEDDWMENIDVCENCHYPIVPLDGKATLLMRNGSEVRDPLVTYEDSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQNGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDKGGFYISPRITFPGLHELVRHYTNTPDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPPGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVQPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLEDFFTATEGQYQPQP
Download sequence
Identical sequences G5BU89
XP_012929866.1.39548 XP_012929867.1.39548 HGL_H00000362663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]