SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012930733.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012930733.1.39548
Domain Number 1 Region: 7-122
Classification Level Classification E-value
Superfamily POZ domain 1.18e-26
Family BTB/POZ domain 0.0021
Further Details:      
 
Domain Number 2 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-19
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 502-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-16
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Weak hits

Sequence:  XP_012930733.1.39548
Domain Number - Region: 638-665
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000509
Family Classic zinc finger, C2H2 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012930733.1.39548
Sequence length 667
Comment PREDICTED: zinc finger and BTB domain-containing protein 20 isoform X2 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MTERIHSINLHNFSNSVLETLNEQRNRGHFCDVTVRIHGSMLRAHRCVLAAGSPFFQDKL
LLGYSDIEIPSVVSVQSVQKLIDFMYSGVLRVSQSEALQILTAASILQIKTVIDECTRIV
SQNVGDVFPGIQDSGQDTPRGTPESGTSGQSSDTESGYLQSHPQHSVDRIYSALYACSMQ
NGSGERSFYSGAVVSHHETALSLPRDHHMEDPNWITRIHERSQMERYMSTTPETTHCRKQ
PRPVRIQTLMGNIHIKQEMEDDYDYYGQQRVQILERNESEECTEDTDQAEGTESEPKGES
FDSGVSSSIGTEPDSVEQQFGTGATRDGQSDPTQPEQAAEAPTEGSAQPNQLETGASSPE
RSNEVEMDSTVITVSNSSDKSILQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLT
SNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQFVTVSQPGLSTFTAQL
PAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTGEKPHQCSICWRS
FSLKDYLIKHMVTHTGVRAYQCSICNKRFTQKSSLNVHMRLHRGEKSYECYICKKKFSHK
TLLERHVALHSASNGTPPAGTPPGARAGPPGVVACTEGTTYVCSVCPAKFDQIEQFNDHM
RMHVSDG
Download sequence
Identical sequences G5AL40
XP_012930733.1.39548 HGL_H00000419153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]