SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012984204.1.78019 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012984204.1.78019
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-56
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 180-415
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-50
Family YWTD domain 0.00000351
Further Details:      
 
Domain Number 3 Region: 784-1043
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-40
Family YWTD domain 0.00004
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-28
Family YWTD domain 0.0000538
Further Details:      
 
Domain Number 5 Region: 738-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000574
Family EGF-type module 0.022
Further Details:      
 
Domain Number 6 Region: 1174-1212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1095-1135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000191
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000024
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1053-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000037
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012984204.1.78019
Sequence length 1365
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X2 [Melopsittacus undulatus]; AA=GCF_000238935.1; RF=representative genome; TAX=13146; STAX=13146; NAME=Melopsittacus undulatus; AL=Scaffold; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGSSRSIIVNTDIYWPNGLTLDYEEQKLYWADAKLNFIHRSNL
DGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGEDLREIHSNIFSPMDI
HAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLENGKTCKDGATELL
LLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTDDEVRAIRRSFIDG
SGSQFIVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMVGYMYWTDWGEMPKIERAALDGSDRIVLVNTSLGWPNGLALDYAENKIYWGDAKT
DKIEVMNADGTGRRILVEDKLPHIFGFTLLGDYVYWTDWQRRSIERVHKRTAEREIIIDQ
LPDLMGLKATNVHQIIGTNPCAEDNGGCSHLCLYRPQGLRCACPIGLELINDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAGMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVSGFVCGCPAHYSLNSDNRTCSA
PTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKHLYWIDSRQNIIRK
AQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPMGVV
LKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALAIDS
QLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKID
MTGREGRTKVQARIAQLSDIHAVKELNIQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCP
VHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDT
QFQCQSGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIGKSKKCDHNLDC
SDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETMTN
DYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSS
SSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYR
Download sequence
Identical sequences XP_012984204.1.78019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]