SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013004092.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013004092.1.53824
Domain Number 1 Region: 136-247
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-31
Family C-type lectin domain 0.00000647
Further Details:      
 
Weak hits

Sequence:  XP_013004092.1.53824
Domain Number - Region: 103-132
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000575
Family Triple coiled coil domain of C-type lectins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013004092.1.53824
Sequence length 249
Comment PREDICTED: mannose-binding protein A-like [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MLLFPWLLVLLLCVVRDCCSEVKACEDAQKTCSVVVCGIPVTNGTPGRDGRDGPKGEKGD
PGQGLRGLQGPPGKLGPPGKTGGSGPSGSKGQKGERGDSSVAESKLANLEREIRTLKSEL
NSIRKLQGFSLGKKSGKKFYVTNGEKMSFAKVKGLCAELGGTVATPRNAEENKAVQEVAK
DNVFLGITDEVTEGQFMYVTGGRLAYSNWKKDEPNDYGTGEDCVILKTDGTWNDITCTAA
FLAVCEFSA
Download sequence
Identical sequences ENSCPOP00000014761 ENSCPOP00000014761 XP_003466202.1.53824 XP_013004092.1.53824 XP_013004094.1.53824 10141.ENSCPOP00000014761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]